PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P25900_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 711aa    MW: 78233.1 Da    PI: 6.2119
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P25900_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.8e-211671156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                            +++ +++t+ q++eLe++F+ +++p++++r++L++ lgL+ rq+k+WFqNrR+++k
  GSMUA_Achr10P25900_001 16 KKRYHRHTPRQIQELESMFKVCPHPDEKQRKQLSRDLGLEPRQIKFWFQNRRTQMK 71
                            688999***********************************************998 PP

2START176.61.5e-552244473206
                             HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                   START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                             a  a++e+++ ++ +ep+Wvks     ++++ +++ + f++s         ++ea+r+s++v m++++lv  ++d + +W e ++  
  GSMUA_Achr10P25900_001 224 ATGAMEEVIRVVQTDEPLWVKSGsdgrDILQLETYDRMFQRSARqlrfsdTRVEASRDSALVVMNAVTLVDMFMDAS-KWGELFPti 309
                             66799*****************98898555555555555444336679999**************************.999999999 PP

                             ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                   START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                               ka t+ev+  g      g l+lm+ elq+lsp+vp Rdf f+Ry++q +  +w+++dvSvd + +++  +++ R+++lpSg+lie
  GSMUA_Achr10P25900_001 310 vsKARTVEVLAAGmagsrsGSLVLMYEELQVLSPVVPtRDFCFLRYCQQIEPSVWAVADVSVDFPGDNQ-LAPSSRSRRLPSGCLIE 395
                             99******************************************************************9.7**************** PP

                             EECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                   START 156 pksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                             +++ng+skvtwveh++ +++ p h+l+r l+  g+a+ga++w+atlqr ce+
  GSMUA_Achr10P25900_001 396 EMPNGYSKVTWVEHMEIEEKNPiHALFRDLIDGGMAFGAQRWLATLQRMCER 447
                             **************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-22472IPR009057Homeodomain-like
SuperFamilySSF466897.1E-20771IPR009057Homeodomain-like
PROSITE profilePS5007117.4271373IPR001356Homeobox domain
SMARTSM003893.4E-191477IPR001356Homeobox domain
CDDcd000864.41E-191571No hitNo description
PfamPF000461.4E-181671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084852.905213450IPR002913START domain
SuperFamilySSF559613.85E-35215448No hitNo description
CDDcd088756.97E-113217446No hitNo description
SMARTSM002343.7E-47222447IPR002913START domain
PfamPF018523.4E-48226447IPR002913START domain
Gene3DG3DSA:3.30.530.201.7E-8310442IPR023393START-like domain
SuperFamilySSF559616.72E-25470703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MDSGDEQDVP DSQGRKKRYH RHTPRQIQEL ESMFKVCPHP DEKQRKQLSR DLGLEPRQIK  60
FWFQNRRTQM KATALLPAQQ ERADNCLLRA ENDKIRCENI AMREALRNVI CPSCGGPPPD  120
DDPYFDEQNL RMENAKLKEE PMSSLIHFDG GGSNKHTSTH SFNVILLSLI HANESLQLDR  180
VSSLASKYLG RPITQLPPSS SSAFPYPFPA SMSELDKPLM VEMATGAMEE VIRVVQTDEP  240
LWVKSGSDGR DILQLETYDR MFQRSARQLR FSDTRVEASR DSALVVMNAV TLVDMFMDAS  300
KWGELFPTIV SKARTVEVLA AGMAGSRSGS LVLMYEELQV LSPVVPTRDF CFLRYCQQIE  360
PSVWAVADVS VDFPGDNQLA PSSRSRRLPS GCLIEEMPNG YSKVTWVEHM EIEEKNPIHA  420
LFRDLIDGGM AFGAQRWLAT LQRMCERFAC LNVAGIPARD IGGKELAPSP DGKRSMMKLA  480
QRMVTNFCAN VGASNGHKWT TLSGVNDVGV RVTLHKNTDA GQPNGVVLSA ATSIWLPISA  540
ERIFSFFKDE RTRTQWDVLS NGNTVQEVAH ITNGSHPGNC ISLLRGLNSG QNTMLILQEC  600
CTDASGSVVV YSPVDLPAIN IVMSGEDPSY VPILPSGFTI LPDGRSAGGY GASSSSNPMG  660
GSAGSLVTVA FQILMSSLPS AKLNLESVMT VNNLIGTTVQ QIKAALSCPD V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381006.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLM0RLG40.0M0RLG4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P25900_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11